Products

View as table Download

IKZF1 Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IKZF1

Goat Polyclonal Antibody against IKZF1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DLLRAASENSQDALR, from the internal region of the protein sequence according to NP_006051.1.

Ikaros (IKZF1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 422-452aa) of human IKZF1.

Mouse Monoclonal Ikaros (C-terminus) Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-ZNFN1A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNFN1A1 antibody: synthetic peptide directed towards the middle region of human ZNFN1A1. Synthetic peptide located within the following region: LHKPLAEGTPRSNHSAQDSAVENLLLLSKAKLVPSEREASPSNSCQDSTD

Rabbit Polyclonal anti-IKZF1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IKZF1 antibody: synthetic peptide directed towards the middle region of human IKZF1. Synthetic peptide located within the following region: DLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEK

Rabbit Polyclonal Anti-IKZF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IKZF1 antibody: synthetic peptide directed towards the middle region of human IKZF1. Synthetic peptide located within the following region: QDSTDTESNNEEQRSGLIYLTNHIAPHARNGLSLKEEHRAYDLLRAASEN

Ikzf1 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

Ikzf1 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

IKZF1 Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human IKZF1

Ikaros Rabbit polyclonal Antibody

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Ikaros