Products

View as table Download

Rabbit Polyclonal Anti-Ppp3cb Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ppp3cb antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI

Rabbit Polyclonal Anti-Ppp3cb Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ppp3cb antibody is: synthetic peptide directed towards the middle region of Rat Ppp3cb. Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS

Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298)

Rabbit polyclonal anti-Calcineurin A antibody

Applications WB
Reactivities Bovine, Hamster, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to residues surrounding amino acids 267 of human Calcineurin A

Carrier-free (BSA/glycerol-free) PPP3CB mouse monoclonal antibody,clone OTI2E4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP3CB Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PPP3CB

PPP3CB Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 286-525 of human PPP3CB (NP_001135825.1).
Modifications Unmodified

PPP3CB mouse monoclonal antibody,clone OTI2E4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP3CB mouse monoclonal antibody,clone OTI2E4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated