Products

Jump to Filters
View as table Download
Nogo A (RTN4) (Isoform 1) (C-term) Rabbit Polyclonal Antibody
AP23267PU-N

USD 405.00

2 Weeks

Nogo A (RTN4) (Isoform 1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to the C-terminal of human Nogo-A
Nogo A (RTN4) Rabbit Polyclonal Antibody
TA306413

USD 430.00

5 Days

Rabbit Polyclonal NogoA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NogoA antibody was raised against a 23 amino acid peptide from near the amino terminus of human NogoA.
Nogo A (RTN4) Rabbit Polyclonal Antibody
TA321797

USD 345.00

In Stock

Anti-RTN4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1179-1194 amino acids of Human reticulon 4
Nogo A (RTN4) Rabbit Polyclonal Antibody
TA306414

USD 430.00

5 Days

Rabbit Polyclonal NogoA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NogoA antibody was raised against a 19 amino acid peptide from near the center of human NogoA.
Nogo A (RTN4) Rabbit Polyclonal Antibody
TA336446

USD 457.00

5 Days

Rabbit Polyclonal Nogo Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic sequence corresponding to amino acids 14-30 (DSPPRPQPAFKYQFVRE) of human Nogo A was used as the immunogen for this antibody.
Nogo A (RTN4) Rabbit Polyclonal Antibody
TA341874

USD 375.00

5 Days

Rabbit Polyclonal Anti-RTN4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RTN4 antibody: synthetic peptide directed towards the middle region of human RTN4. Synthetic peptide located within the following region: FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI
Nogo A (RTN4) Rabbit Polyclonal Antibody
TA341875

USD 375.00

5 Days

Rabbit Polyclonal Anti-RTN4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RTN4 antibody: synthetic peptide directed towards the middle region of human RTN4. Synthetic peptide located within the following region: RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV
Nogo A (RTN4) Rabbit Polyclonal Antibody
TA381185

USD 275.00

3 Weeks

RTN4 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RTN4.
Modifications Unmodified