Products

View as table Download

Rabbit anti-IMPDH2 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IMPDH2

Rabbit Polyclonal Anti-IMPDH2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IMPDH2 Antibody: synthetic peptide directed towards the N terminal of human IMPDH2. Synthetic peptide located within the following region: MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVD

Goat Anti-IMPDH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KEEEHDCFLEEI, from the internal region of the protein sequence according to NP_000875.2.

Rabbit Polyclonal Anti-IMPDH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IMPDH2 Antibody: synthetic peptide directed towards the C terminal of human IMPDH2. Synthetic peptide located within the following region: SCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF

Carrier-free (BSA/glycerol-free) IMPDH2 mouse monoclonal antibody,clone OTI2F10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-IMPDH2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human IMPDH2

IMPDH2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 215-514 of human IMPDH2 (NP_000875.2).
Modifications Unmodified

IMPDH2 mouse monoclonal antibody,clone OTI2F10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

IMPDH2 mouse monoclonal antibody,clone OTI2F10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated