Products

View as table Download

SOX10 mouse monoclonal antibody, clone 1E6, Purified

Applications ELISA, IHC, WB
Reactivities Human

Rabbit Polyclonal Anti-SOX10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOX10 Antibody: synthetic peptide directed towards the middle region of human SOX10. Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT

Rabbit Polyclonal Anti-SOX10 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SOX10 antibody was raised against a peptide corresponding to 18 amino acids near the amino terminus of human SOX10.