Products

View as table Download

DNase I (DNASE1) (1-252) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 252 of DNase I.

Rabbit Polyclonal antibody to DNase I (deoxyribonuclease I)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 282 of DNase I (Uniprot ID#P24855)

Rabbit Polyclonal Anti-DNASE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNASE1 antibody: synthetic peptide directed towards the N terminal of human DNASE1. Synthetic peptide located within the following region: GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD

Rabbit Polyclonal Anti-DNASE1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DNASE1