Products

View as table Download

GATA6 mouse monoclonal antibody, clone OTI2B3 (formerly 2B3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

Rabbit Polyclonal anti-GATA6 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA6 antibody: synthetic peptide directed towards the middle region of human GATA6. Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS

Rabbit Polyclonal Anti-GATA6 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA6 antibody: synthetic peptide directed towards the N terminal of human GATA6. Synthetic peptide located within the following region: PEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAAAAASSPVYVPTTR

Rabbit polyclonal anti-GATA6 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human GATA6.

Mouse Monoclonal GATA6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit anti GATA-6 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Anti-GATA6 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 9-23 amino acids of Human GATA binding protein 6

Anti-GATA6 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 9-23 amino acids of Human GATA binding protein 7

GATA6 mouse monoclonal antibody, clone OTI2B3 (formerly 2B3), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

GATA6 mouse monoclonal antibody, clone OTI2B3 (formerly 2B3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

GATA6 Rabbit monoclonal antibody,clone OTIR5F2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GATA6 Rabbit monoclonal antibody,clone OTIR5F2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GATA6 Rabbit monoclonal antibody,clone OTIR5B8

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

GATA6 Rabbit monoclonal antibody,clone OTIR5B8

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

GATA6 Rabbit monoclonal antibody,clone OTIR3H6

Applications WB
Reactivities Human
Conjugation Unconjugated

GATA6 Rabbit monoclonal antibody,clone OTIR3H6

Applications WB
Reactivities Human
Conjugation Unconjugated