Rabbit Polyclonal CARD8 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CARD8 antibody was raised against a synthetic peptide corresponding to amino acids at the C-terminus of human CARD8. |
Rabbit Polyclonal CARD8 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CARD8 antibody was raised against a synthetic peptide corresponding to amino acids at the C-terminus of human CARD8. |
CARD8 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CARD8 |
Anti-CARD8 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 200 amino acids of human Caspase recruitment domain-containing protein 8 |
Rabbit Polyclonal Anti-CARD8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CARD8 Antibody is: synthetic peptide directed towards the N-terminal region of Human CARD8. Synthetic peptide located within the following region: LGGTFPGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELID |
Rabbit Polyclonal Anti-CARD8 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CARD8 |