Rabbit polyclonal Anti-Mafa Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mafa antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KLEVGRLAKERDLYKEKYEKLAGRGGPGGAGGAGFPREPSPAQAGPGAAK |
Rabbit polyclonal Anti-Mafa Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mafa antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GGGSAAQAGGAPGPPSGGPGTVGGASGKAVLEDLYWMSGYQHHLNPEALN |
Rabbit Polyclonal Anti-MAFA Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAFA antibody: synthetic peptide directed towards the N terminal of human MAFA. Synthetic peptide located within the following region: KPALEDLYWMSGYQHHLNPEALNLTPEDAVEALIGSGHHGAHHGAHHPAA |
Germany
Japan
United Kingdom
China
