Products

View as table Download

Rabbit Polyclonal Anti-ACD Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACD antibody: synthetic peptide directed towards the C terminal of human ACD. Synthetic peptide located within the following region: SSQPSPAICSAPATLTPRSPHASRTPSSPLQSCTPSLSPRSHVPSPHQAL

Rabbit Polyclonal Anti-ACD Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACD antibody: synthetic peptide directed towards the middle region of human ACD. Synthetic peptide located within the following region: KNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQ

ACD rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACD

Rabbit Polyclonal Anti-Acd Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Acd antibody: synthetic peptide directed towards the c terminal of mouse Acd. Synthetic peptide located within the following region: PRTSAQELCSVWEPPERHRDTSAFQYKYETPSASLHTQVQTARLSPQLVA

Carrier-free (BSA/glycerol-free) ACD mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ACD mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ACD mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

ACD rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACD

ACD mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

ACD mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

ACD mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ACD mouse monoclonal antibody, clone OTI2B1 (formerly 2B1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ACD mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

ACD mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated