Products

cDNA Clones (62)
Proteins (42)
RNAi (9)
Gene Expression (8)
Antibodies (4)
Jump to Filters
View as table Download
APOL3 Goat Polyclonal Antibody
TA305719

USD 375.00

5 Days

Goat Anti-APOL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence ELTQIYQRLNPCHTH, from the C Terminus of the protein sequence according to NP_663615.1, NP_055164.1, NP_663616.1.
APOL3 Rabbit Polyclonal Antibody
TA331371

USD 375.00

5 Days

Rabbit Polyclonal Anti-APOL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-APOL3 antibody is: synthetic peptide directed towards the middle region of Human APOL3. Synthetic peptide located within the following region: AIEDEYVQQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEVHRGC
APOL3 Rabbit Polyclonal Antibody
TA331372

USD 375.00

5 Days

Rabbit Polyclonal Anti-APOL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-APOL3 antibody is: synthetic peptide directed towards the N-terminal region of Human APOL3. Synthetic peptide located within the following region: DARLEVGSTQLRTAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQI
APOL3 Rabbit Polyclonal Antibody
TA373606

USD 220.00

3 Weeks

APOL3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-331 of human APOL3 (NP_663614.1).
Modifications Unmodified