Products

View as table Download

BFAR (C-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen BFAR antibody was raised against synthetic peptide - KLH conjugated

Rabbit Polyclonal BFAR Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen BFAR antibody was raised against a 14 amino acid peptide near the carboxy terminus of human BFAR.

BFAR (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human BFAR

Rabbit Polyclonal Anti-BFAR Antibody

Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Bfar antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NDVVQSLAAFQKYGNDQNPLAPSTGRVNPQRGGGFFSGVLTALTGVAVIL

Rabbit Polyclonal Anti-BFAR Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human BFAR

BFAR rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human BFAR

BFAR Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human BFAR (NP_057645.1).
Modifications Unmodified