Products

cDNA Clones (38)
RNAi (12)
Gene Expression (10)
Antibodies (7)
Proteins (5)
Jump to Filters
View as table Download
BFAR (NM_016561) Human Tagged ORF Clone
RC200078

USD 98.00

USD 560.00

In Stock

BFAR (Myc-DDK-tagged)-Human bifunctional apoptosis regulator (BFAR)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
BFAR (NM_016561) Human Tagged ORF Clone Lentiviral Particle
RC200078L1V

USD 1,020.00

2 Weeks

Lenti ORF particles, BFAR (Myc-DDK tagged) - Human bifunctional apoptosis regulator (BFAR), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
BFAR (NM_016561) Human Tagged ORF Clone Lentiviral Particle
RC200078L2V

USD 1,020.00

5 Weeks

Lenti ORF particles, BFAR (mGFP-tagged) - Human bifunctional apoptosis regulator (BFAR), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Bfar (NM_025653) Mouse Tagged ORF Clone
MR204428

USD 68.00

USD 149.00

In Stock

3110001I22Rik (Myc-DDK-tagged) - Mouse RIKEN cDNA 3110001I22 gene (3110001I22Rik)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Bfar (NM_025976) Mouse Tagged ORF Clone
MR207190

USD 350.00

In Stock

Bfar (Myc-DDK-tagged) - Mouse bifunctional apoptosis regulator (Bfar), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Bfar (NM_001177552) Mouse Tagged ORF Clone
MR219635

USD 68.00

USD 149.00

In Stock

Bfar (Myc-DDK-tagged) - Mouse bifunctional apoptosis regulator (Bfar), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
BFAR (NM_016561) Human Tagged ORF Clone
RG200078

USD 460.00

In Stock

BFAR (GFP-tagged) - Human bifunctional apoptosis regulator (BFAR)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BFAR Human Gene Knockout Kit (CRISPR)
KN400078

USD 1,290.00

2 Weeks

BFAR - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN400078 is the updated version of KN200078.
Bfar Mouse Gene Knockout Kit (CRISPR)
KN502147

USD 1,290.00

2 Weeks

Bfar - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN502147 is the updated version of KN302147.
Bfar (NM_025653) Mouse Tagged ORF Clone
MG204428

USD 300.00

3 Weeks

3110001I22Rik (GFP-tagged) - Mouse RIKEN cDNA 3110001I22 gene (3110001I22Rik)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Bfar (NM_025976) Mouse Tagged ORF Clone
MG207190

USD 390.00

3 Weeks

Bfar (GFP-tagged) - Mouse bifunctional apoptosis regulator (Bfar)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Bfar (NM_001177552) Mouse Tagged ORF Clone
MG219635

USD 300.00

3 Weeks

Bfar (GFP-tagged) - Mouse bifunctional apoptosis regulator (Bfar) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Bfar (NM_025653) Mouse Tagged ORF Clone
MR204428L3

USD 500.00

3 Weeks

Lenti ORF clone of 3110001I22Rik (Myc-DDK-tagged) - Mouse RIKEN cDNA 3110001I22 gene (3110001I22Rik)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Bfar (NM_025653) Mouse Tagged ORF Clone Lentiviral Particle
MR204428L3V

USD 700.00

6 Weeks

Lenti ORF particles, 3110001I22Rik (Myc-DDK-tagged) - Mouse RIKEN cDNA 3110001I22 gene (3110001I22Rik), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Bfar (NM_025653) Mouse Tagged ORF Clone
MR204428L4

USD 500.00

3 Weeks

Lenti ORF clone of 3110001I22Rik (mGFP-tagged) - Mouse RIKEN cDNA 3110001I22 gene (3110001I22Rik)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Bfar (NM_025653) Mouse Tagged ORF Clone Lentiviral Particle
MR204428L4V

USD 700.00

6 Weeks

Lenti ORF particles, 3110001I22Rik (GFP-tagged) - Mouse RIKEN cDNA 3110001I22 gene (3110001I22Rik), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Bfar (NM_025976) Mouse Tagged ORF Clone
MR207190L3

USD 550.00

3 Weeks

Lenti ORF clone of Bfar (Myc-DDK-tagged) - Mouse bifunctional apoptosis regulator (Bfar), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Bfar (NM_025976) Mouse Tagged ORF Clone Lentiviral Particle
MR207190L3V

USD 750.00

6 Weeks

Lenti ORF particles, Bfar (Myc-DDK-tagged) - Mouse bifunctional apoptosis regulator (Bfar), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Bfar (NM_025976) Mouse Tagged ORF Clone
MR207190L4

USD 550.00

3 Weeks

Lenti ORF clone of Bfar (mGFP-tagged) - Mouse bifunctional apoptosis regulator (Bfar), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Bfar (NM_025976) Mouse Tagged ORF Clone Lentiviral Particle
MR207190L4V

USD 750.00

6 Weeks

Lenti ORF particles, Bfar (GFP-tagged) - Mouse bifunctional apoptosis regulator (Bfar), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Bfar (NM_001177552) Mouse Tagged ORF Clone
MR219635L3

USD 500.00

3 Weeks

Lenti ORF clone of Bfar (Myc-DDK-tagged) - Mouse bifunctional apoptosis regulator (Bfar), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Bfar (NM_001177552) Mouse Tagged ORF Clone Lentiviral Particle
MR219635L3V

USD 700.00

6 Weeks

Lenti ORF particles, Bfar (Myc-DDK-tagged) - Mouse bifunctional apoptosis regulator (Bfar), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Bfar (NM_001177552) Mouse Tagged ORF Clone
MR219635L4

USD 500.00

3 Weeks

Lenti ORF clone of Bfar (mGFP-tagged) - Mouse bifunctional apoptosis regulator (Bfar), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Bfar (NM_001177552) Mouse Tagged ORF Clone Lentiviral Particle
MR219635L4V

USD 700.00

6 Weeks

Lenti ORF particles, Bfar (GFP-tagged) - Mouse bifunctional apoptosis regulator (Bfar), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BFAR (NM_016561) Human Tagged Lenti ORF Clone
RC200078L3

USD 768.00

3 Weeks

Lenti ORF clone of Human bifunctional apoptosis regulator (BFAR), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BFAR (NM_016561) Human Tagged ORF Clone Lentiviral Particle
RC200078L3V

USD 1,020.00

5 Weeks

Lenti ORF particles, BFAR (Myc-DDK tagged) - Human bifunctional apoptosis regulator (BFAR), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BFAR (NM_016561) Human Tagged Lenti ORF Clone
RC200078L4

USD 768.00

3 Weeks

Lenti ORF clone of Human bifunctional apoptosis regulator (BFAR), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BFAR (NM_016561) Human Tagged ORF Clone Lentiviral Particle
RC200078L4V

USD 1,020.00

5 Weeks

Lenti ORF particles, BFAR (mGFP-tagged) - Human bifunctional apoptosis regulator (BFAR), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Bfar (NM_001013125) Rat Tagged ORF Clone
RR204448

USD 610.00

4 Weeks

Bfar (Myc-DDK-tagged ORF) - Rat bifunctional apoptosis regulator (Bfar), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Bfar (NM_001013125) Rat Tagged ORF Clone
RR204448L3

USD 810.00

9 Weeks

Lenti ORF clone of Bfar (Myc-DDK-tagged ORF) - Rat bifunctional apoptosis regulator (Bfar), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Bfar (NM_001013125) Rat Tagged ORF Clone Lentiviral Particle
RR204448L3V

USD 1,030.00

13 Weeks

Lenti ORF particles, Bfar (Myc-DDK-tagged ORF) - Rat bifunctional apoptosis regulator (Bfar), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Bfar (NM_001013125) Rat Tagged ORF Clone
RR204448L4

USD 890.00

9 Weeks

Lenti ORF clone of Bfar (mGFP-tagged ORF) - Rat bifunctional apoptosis regulator (Bfar), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Bfar (NM_001013125) Rat Tagged ORF Clone Lentiviral Particle
RR204448L4V

USD 1,140.00

13 Weeks

Lenti ORF particles, Bfar (GFP-tagged ORF) - Rat bifunctional apoptosis regulator (Bfar), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BFAR (C-term) Rabbit Polyclonal Antibody
AP23503PU-N

USD 440.00

2 Weeks

BFAR (C-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen BFAR antibody was raised against synthetic peptide - KLH conjugated
BFAR (NM_016561) Human Tagged Lenti ORF Clone
RC200078L1

USD 768.00

In Stock

Lenti ORF clone of Human bifunctional apoptosis regulator (BFAR), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
BFAR (NM_016561) Human Tagged Lenti ORF Clone
RC200078L2

USD 768.00

3 Weeks

Lenti ORF clone of Human bifunctional apoptosis regulator (BFAR), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
BFAR Rabbit Polyclonal Antibody
TA306918

USD 430.00

5 Days

Rabbit Polyclonal BFAR Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen BFAR antibody was raised against a 14 amino acid peptide near the carboxy terminus of human BFAR.
BFAR (NM_016561) Human Over-expression Lysate
LC402568

USD 121.00

In Stock

BFAR HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Bfar (NM_025976) Mouse Untagged Clone
MC201469

USD 210.00

In Stock

Bfar (untagged) - Mouse bifunctional apoptosis regulator (Bfar), transcript variant 1, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
BFAR (NM_016561) Human Untagged Clone
SC319484

USD 310.00

In Stock

BFAR (untagged)-Human bifunctional apoptosis regulator (BFAR)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
BFAR (N-term) Rabbit Polyclonal Antibody
AP50370PU-N

USD 450.00

2 Weeks

BFAR (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human BFAR
Bfar Rabbit Polyclonal Antibody
TA329862

USD 375.00

5 Days

Rabbit Polyclonal Anti-BFAR Antibody

Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Bfar antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NDVVQSLAAFQKYGNDQNPLAPSTGRVNPQRGGGFFSGVLTALTGVAVIL
Human BFAR activation kit by CRISPRa
GA109703

USD 1,290.00

2 Weeks

BFAR CRISPRa kit - CRISPR gene activation of human bifunctional apoptosis regulator

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Bfar activation kit by CRISPRa
GA207148

USD 1,290.00

2 Weeks

Bfar CRISPRa kit - CRISPR gene activation of mouse bifunctional apoptosis regulator

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
BFAR Human qPCR Template Standard (NM_016561)
HK201089

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene BFAR

Application Plasmid of exact quantity for transcript copy number calculation
BFAR Human qPCR Template Standard (NM_016561)
HK201090

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene BFAR

Application Plasmid of exact quantity for transcript copy number calculation
BFAR Human qPCR Primer Pair (NM_016561)
HP212263

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene BFAR

Bfar (NM_025653) Mouse Untagged Clone
MC207588

USD 420.00

3 Weeks

3110001I22Rik (untagged) - Mouse RIKEN cDNA 3110001I22 gene (3110001I22Rik), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Bfar Mouse qPCR Template Standard (NM_025976)
MK201057

USD 330.00

5 Days

qPCR primer pairs and template standards against Mus musculus gene Bfar

Application Plasmid of exact quantity for transcript copy number calculation