Products

View as table Download

Goat Anti-CAV3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Peptide with sequence EHTDLEAQIVKDIH-C, from the N Terminus of the protein sequence according to NP_203123.1.

Rabbit Polyclonal Anti-CAV3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAV3 antibody: synthetic peptide directed towards the N terminal of human CAV3. Synthetic peptide located within the following region: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVG

Caveolin 3 (CAV3) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human CAV3

Rabbit Polyclonal Anti-CAV3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CAV3

CAV3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CAV3

Caveolin-3 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Caveolin-3 (NP_001225.1).
Modifications Unmodified