Products

cDNA Clones (33)
RNAi (13)
Proteins (12)
Antibodies (6)
Gene Expression (6)
Jump to Filters
View as table Download
Caveolin 3 (CAV3) (NM_001234) Human Tagged ORF Clone
RC210118

USD 98.00

USD 390.00

In Stock

CAV3 (Myc-DDK-tagged)-Human caveolin 3 (CAV3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Cav3 (NM_007617) Mouse Tagged ORF Clone
MR226246

USD 420.00

In Stock

Cav3 (Myc-DDK-tagged) - Mouse caveolin 3 (Cav3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Caveolin 3 (CAV3) (NM_001234) Human Tagged ORF Clone
RG210118

USD 460.00

In Stock

CAV3 (GFP-tagged) - Human caveolin 3 (CAV3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Caveolin 3 (CAV3) (NM_033337) Human Tagged ORF Clone
RG221140

USD 460.00

In Stock

CAV3 (GFP-tagged) - Human caveolin 3 (CAV3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cav3 (NM_007617) Mouse Tagged ORF Clone
MG226246

USD 460.00

In Stock

Cav3 (GFP-tagged) - Mouse caveolin 3 (Cav3), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cav3 Mouse Gene Knockout Kit (CRISPR)
KN502591

USD 1,290.00

2 Weeks

Cav3 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN502591 is the updated version of KN302591.
Cav3 (NM_007617) Mouse Tagged ORF Clone
MR226246L3

USD 620.00

3 Weeks

Lenti ORF clone of Cav3 (Myc-DDK-tagged) - Mouse caveolin 3 (Cav3)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cav3 (NM_007617) Mouse Tagged ORF Clone
MR226246L4

USD 620.00

3 Weeks

Lenti ORF clone of Cav3 (mGFP-tagged) - Mouse caveolin 3 (Cav3)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Caveolin 3 (CAV3) (NM_001234) Human Tagged ORF Clone
RC210118L4

USD 620.00

In Stock

Lenti ORF clone of Human caveolin 3 (CAV3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Caveolin 3 (CAV3) (NM_033337) Human Tagged ORF Clone
RC221140L3

USD 620.00

3 Weeks

Lenti ORF clone of Human caveolin 3 (CAV3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Caveolin 3 (CAV3) (NM_033337) Human Tagged ORF Clone
RC221140L4

USD 620.00

3 Weeks

Lenti ORF clone of Human caveolin 3 (CAV3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cav3 (NM_019155) Rat Tagged ORF Clone
RR211453

USD 420.00

3 Weeks

Cav3 (Myc-DDK-tagged ORF) - Rat caveolin 3 (Cav3), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cav3 (NM_019155) Rat Tagged ORF Clone
RR211453L3

USD 640.00

7 Weeks

Lenti ORF clone of Cav3 (Myc-DDK-tagged ORF) - Rat caveolin 3 (Cav3), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cav3 (NM_019155) Rat Tagged ORF Clone
RR211453L4

USD 700.00

7 Weeks

Lenti ORF clone of Cav3 (mGFP-tagged ORF) - Rat caveolin 3 (Cav3), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Caveolin 3 (CAV3) (NM_001234) Human Untagged Clone
SC302995

USD 420.00

In Stock

CAV3 (untagged)-Human caveolin 3 (CAV3), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Caveolin 3 (CAV3) (NM_033337) Human Untagged Clone
SC305616

USD 420.00

In Stock

CAV3 (untagged)-Human caveolin 3 (CAV3), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Caveolin 3 (CAV3) Goat Polyclonal Antibody
TA305791

USD 375.00

In Stock

Goat Anti-CAV3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Peptide with sequence EHTDLEAQIVKDIH-C, from the N Terminus of the protein sequence according to NP_203123.1.
Caveolin 3 (CAV3) (NM_001234) Human Over-expression Lysate
LC420058

USD 121.00

In Stock

CAV3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CAV3 Human siRNA Oligo Duplex (Locus ID 859)
SR300605

USD 430.00

In Stock

CAV3 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Cav3 Mouse siRNA Oligo Duplex (Locus ID 12391)
SR403149

USD 430.00

In Stock

Cav3 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).
Cav3 Rat shRNA Plasmid (Locus ID 29161)
TG710176

USD 715.00

In Stock

Cav3 - Rat, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
Caveolin 3 (CAV3) (NM_001234) Human Tagged ORF Clone
RC210118L2

USD 620.00

3 Weeks

Lenti ORF clone of Human caveolin 3 (CAV3), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Caveolin 3 (CAV3) (NM_033337) Human Tagged ORF Clone
RC221140L2

USD 620.00

3 Weeks

Lenti ORF clone of Human caveolin 3 (CAV3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CAV3 Human shRNA Plasmid Kit (Locus ID 859)
TL305626

USD 815.00

In Stock

CAV3 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin
Caveolin 3 (CAV3) Rabbit Polyclonal Antibody
TA330403

USD 375.00

5 Days

Rabbit Polyclonal Anti-CAV3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAV3 antibody: synthetic peptide directed towards the N terminal of human CAV3. Synthetic peptide located within the following region: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVG
Caveolin 3 (CAV3) (N-term) Rabbit Polyclonal Antibody
AP17187PU-N

USD 450.00

2 Weeks

Caveolin 3 (CAV3) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human CAV3
CAV3 Human shRNA Plasmid Kit (Locus ID 859)
TG305626

USD 715.00

2 Weeks

CAV3 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
E. coli Selection Kanamycin
Mammalian Cell Selection Puromycin
Human Caveolin 3 (CAV3) activation kit by CRISPRa
GA100603

USD 1,290.00

2 Weeks

CAV3 CRISPRa kit - CRISPR gene activation of human caveolin 3

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Cav3 activation kit by CRISPRa
GA200552

USD 1,290.00

2 Weeks

Cav3 CRISPRa kit - CRISPR gene activation of mouse caveolin 3

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Caveolin 3 (CAV3) Human qPCR Template Standard (NM_001234)
HK208895

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene CAV3

Application Plasmid of exact quantity for transcript copy number calculation
Caveolin 3 (CAV3) Human qPCR Primer Pair (NM_033337)
HP233547

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene CAV3

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Caveolin 3 (CAV3) (NM_033337) Human Over-expression Lysate
LC409590

USD 121.00

2 Weeks

CAV3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Cav3 (NM_007617) Mouse Untagged Clone
MC208219

USD 420.00

2 Weeks

Cav3 (untagged) - Mouse caveolin 3 (Cav3), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Cav3 Mouse qPCR Primer Pair (NM_007617)
MP201850

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Cav3