Caveolin 3 (CAV3) Rabbit Polyclonal Antibody

CAT#: TA330403

Rabbit Polyclonal Anti-CAV3 Antibody

Product Images

WB Suggested Anti-CAV3 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human muscle

• 

  Lanes: Lane 1: 50 ug human placental tissue lysate; Lane 2: 40 ug human placental tissue lysate; Lane 3: 30 ug human placental tissue lysate; Lane 4: 20 ug human placental tissue lysate; Lane 5: 20 ug human myometrial tissue lysate; Primary Antibody Dilution:

• 

  Sample Type : Human placental tissue Primary Antibody Dilution : 1:50Secondary Antibody : Goat anti rabbit-HRP Secondary Antibody Dilution : 1:10,000Color/Signal Descriptions : Brown: CAV3 Purple: HaemotoxylinGene Name : CAV3Submitted by : Dr. Hiten D. Mi

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CAV3 antibody: synthetic peptide directed towards the N terminal of human CAV3. Synthetic peptide located within the following region: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: caveolin 3
• Database Link:
  NP_001225
  Entrez Gene 859 Human
  UniProt ID P56539
• Background: CAV3 is a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites.
• Synonyms: LGMD1C; LQT9; VIP-21; VIP21
• Note: Immunogen sequence homology: Bovine: 100%; Human: 100%; Pig: 92%; Mouse: 84%; Rat: 84%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Focal adhesion