Products

View as table Download

Rabbit Polyclonal DCLK1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DCLK1 antibody was raised against a 14 amino acid synthetic peptide near the amino terminus of human DCLK1. The immunogen is located within the last 50 amino acids of DCLK1.

Rabbit Polyclonal Anti-DCLK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCLK1 antibody is: synthetic peptide directed towards the C-terminal region of Human DCLK1. Synthetic peptide located within the following region: IFIACGPEKFRYQDDFLLDESECRVVKSTSYTKIASSSRRSTTKSPGPSR

Carrier-free (BSA/glycerol-free) DCLK1 mouse monoclonal antibody,clone OTI1F8

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-DCLK1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human DCLK1

Rabbit Polyclonal Anti-DCLK1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human DCLK1

DCLK1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DCLK1

DCAMKL1/DCLK1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 630-729 of human DCAMKL1/DCAMKL1/DCLK1 (NP_004725.1).
Modifications Unmodified

DCAMKL1/DCLK1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic Peptide of human DCAMKL1/DCAMKL1/DCLK1
Modifications Unmodified