Products

cDNA Clones (43)
RNAi (11)
Proteins (10)
Gene Expression (9)
Antibodies (3)
Jump to Filters
View as table Download
DPAGT1 Rabbit Polyclonal Antibody
TA319635

USD 430.00

5 Days

Rabbit Polyclonal DPAGT1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen DPAGT1 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human DPAGT1.
DPAGT1 (Center) Rabbit Polyclonal Antibody
AP51309PU-N

USD 450.00

2 Weeks

DPAGT1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 293~323 amino acids from the Central region of Human DPAGT1
DPAGT1 Rabbit Polyclonal Antibody
TA338275

USD 375.00

5 Days

Rabbit Polyclonal Anti-DPAGT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DPAGT1 antibody is: synthetic peptide directed towards the C-terminal region of Human DPAGT1. Synthetic peptide located within the following region: TKSLSFLGTFILKVAESLQLVTVHQSETEDGEFTECNNMTLINLLLKVLG