Products

cDNA Clones (24)
RNAi (12)
Proteins (11)
Antibodies (7)
Gene Expression (6)
Assay Kits (5)
Jump to Filters
View as table Download
FGF9 Rabbit Polyclonal Antibody
TA372969

USD 380.00

4 Weeks

FGF9 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FGF9
FGF9 (N-term) Rabbit Polyclonal Antibody
AP51661PU-N

USD 450.00

2 Weeks

FGF9 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 38-66 amino acids from the N-terminal region of human FGF9
Fgf9 Rabbit Polyclonal Antibody
TA328512

USD 285.00

5 Days

Biotinylated Anti-Murine FGF-9 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Murine
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Murine FGF-9
Fgf9 Rabbit Polyclonal Antibody
TA328513

USD 285.00

5 Days

Anti-Murine FGF-9 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Murine
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Murine FGF-9
Fgf9 Rabbit Polyclonal Antibody
TA335026

USD 375.00

5 Days

Rabbit Polyclonal Anti-Fgf9 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Fgf9 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Fgf9. Synthetic peptide located within the following region: AVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFIS
FGF9 Rabbit Polyclonal Antibody
TA368758

USD 380.00

4 Weeks

FGF9 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FGF9
FGF9 Rabbit Polyclonal Antibody
TA376234

USD 220.00

3 Weeks

FGF9 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-208 of human FGF9 (NP_002001.1).
Modifications Unmodified