Germany
Japan
United Kingdom
China
FGF9 (Myc-DDK-tagged)-Human fibroblast growth factor 9 (glia-activating factor) (FGF9)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Fgf9 (Myc-DDK-tagged) - Mouse fibroblast growth factor 9 (Fgf9)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, FGF9 (Myc-DDK tagged) - Human fibroblast growth factor 9 (glia-activating factor) (FGF9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, FGF9 (mGFP-tagged) - Human fibroblast growth factor 9 (glia-activating factor) (FGF9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Fgf9 (GFP-tagged) - Mouse fibroblast growth factor 9 (Fgf9), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
FGF9 (GFP-tagged) - Human fibroblast growth factor 9 (glia-activating factor) (FGF9)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
FGF9 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN410242 is the updated version of KN210242.
Fgf9 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN505941 is the updated version of KN305941.
Lenti ORF clone of Fgf9 (Myc-DDK-tagged) - Mouse fibroblast growth factor 9 (Fgf9)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fgf9 (Myc-DDK-tagged) - Mouse fibroblast growth factor 9 (Fgf9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Fgf9 (mGFP-tagged) - Mouse fibroblast growth factor 9 (Fgf9)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fgf9 (GFP-tagged) - Mouse fibroblast growth factor 9 (Fgf9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, FGF9 (Myc-DDK tagged) - Human fibroblast growth factor 9 (glia-activating factor) (FGF9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human fibroblast growth factor 9 (glia-activating factor) (FGF9), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, FGF9 (mGFP-tagged) - Human fibroblast growth factor 9 (glia-activating factor) (FGF9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Fgf9 (Myc-DDK-tagged ORF) - Rat fibroblast growth factor 9 (Fgf9), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Fgf9 (Myc-DDK-tagged ORF) - Rat fibroblast growth factor 9 (Fgf9), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fgf9 (Myc-DDK-tagged ORF) - Rat fibroblast growth factor 9 (Fgf9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Fgf9 (mGFP-tagged ORF) - Rat fibroblast growth factor 9 (Fgf9), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fgf9 (GFP-tagged ORF) - Rat fibroblast growth factor 9 (Fgf9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human fibroblast growth factor 9 (glia-activating factor) (FGF9), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human fibroblast growth factor 9 (glia-activating factor) (FGF9), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Purified recombinant protein of Human fibroblast growth factor 9 (glia-activating factor) (FGF9).
| Tag | Tag Free |
| Expression Host | E. coli |
Purified recombinant protein of Mouse fibroblast growth factor 9 (Fgf9).
| Tag | Tag Free |
| Expression Host | E. coli |
FGF9 (untagged)-Human fibroblast growth factor 9 (glia-activating factor) (FGF9)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
FGF9 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FGF9 |
Fgf9 (untagged) - Mouse fibroblast growth factor 9 (Fgf9), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human fibroblast growth factor 9 (glia-activating factor) (FGF9), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
qSTAR qPCR primer pairs against Mus musculus gene Fgf9
Anti-Murine FGF-9 Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Murine |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Murine FGF-9 |
Rabbit Polyclonal Anti-Fgf9 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Fgf9 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Fgf9. Synthetic peptide located within the following region: AVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFIS |
Human FGF9 ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Human FGF9 |
| Reactivities | Human |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of Bovine FGF9. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Bovine FGF9 |
| Format | 8x12 divisible strips |
| Reactivities | Bovine |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of horse equine FGF9. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Equine FGF9 |
| Format | 8x12 divisible strips |
| Reactivities | Equine |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of Pig porcine FGF9. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Pig FGF9 |
| Format | 8x12 divisible strips |
| Reactivities | Pig |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of rabbit FGF9. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Rabbit FGF9 |
| Format | 8x12 divisible strips |
| Reactivities | Rabbit |
FGF9 CRISPRa kit - CRISPR gene activation of human fibroblast growth factor 9
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Fgf9 CRISPRa kit - CRISPR gene activation of mouse fibroblast growth factor 9
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene FGF9
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
FGF9 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of fibroblast growth factor 9 (glia-activating factor) (FGF9)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Fgf9 (untagged ORF) - Rat fibroblast growth factor 9 (Fgf9), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
FGF9 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Fgf9 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Fgf9 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
FGF9 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FGF9 |
Transient overexpression of FGF9 (NM_002010) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- FGF9