Products

cDNA Clones (18)
Proteins (10)
Assay Kits (9)
Gene Expression (7)
RNAi (7)
Antibodies (5)
Jump to Filters
View as table Download
GDF 5 (GDF5) (C-term) Rabbit Polyclonal Antibody
AP51811PU-N

USD 450.00

2 Weeks

GDF 5 (GDF5) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen conjugated synthetic peptide between 350-379 amino acids from the C-terminal region of human BMP14 / GDF5
GDF 5 (GDF5) Rabbit Polyclonal Antibody
TA343293

USD 375.00

5 Days

Rabbit Polyclonal Anti-GDF5 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GDF5 antibody is: synthetic peptide directed towards the C-terminal region of GDF5. Synthetic peptide located within the following region: YLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAP
GDF 5 (GDF5) Rabbit Polyclonal Antibody
TA361886

USD 360.00

5 Days

GDF5 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GDF5
GDF 5 (GDF5) Rabbit Polyclonal Antibody
TA376532

USD 220.00

3 Weeks

GDF5 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human GDF5 (NP_000548.2).
Modifications Unmodified
GDF 5 (GDF5) Rabbit Polyclonal Antibody
TA376533

USD 220.00

3 Weeks

GDF5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 202-501 of human GDF5 (NP_000548.2).
Modifications Unmodified