Germany
Japan
United Kingdom
China
GDF5 (Myc-DDK-tagged)-Human growth differentiation factor 5 (GDF5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Gdf5 (Myc-DDK-tagged) - Mouse growth differentiation factor 5 (Gdf5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, GDF5 (Myc-DDK tagged) - Human growth differentiation factor 5 (GDF5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GDF5 (mGFP-tagged) - Human growth differentiation factor 5 (GDF5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
GDF5 (GFP-tagged) - Human growth differentiation factor 5 (GDF5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GDF5 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN407105 is the updated version of KN207105.
Gdf5 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN506389 is the updated version of KN306389.
Gdf5 (GFP-tagged) - Mouse growth differentiation factor 5 (Gdf5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Gdf5 (Myc-DDK-tagged) - Mouse growth differentiation factor 5 (Gdf5)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gdf5 (Myc-DDK-tagged) - Mouse growth differentiation factor 5 (Gdf5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gdf5 (mGFP-tagged) - Mouse growth differentiation factor 5 (Gdf5)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gdf5 (GFP-tagged) - Mouse growth differentiation factor 5 (Gdf5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human growth differentiation factor 5 (GDF5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GDF5 (Myc-DDK tagged) - Human growth differentiation factor 5 (GDF5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human growth differentiation factor 5 (GDF5), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GDF5 (mGFP-tagged) - Human growth differentiation factor 5 (GDF5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GDF5 (untagged)-Human growth differentiation factor 5 (GDF5)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human growth differentiation factor 5 (GDF5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Purified recombinant protein of Mouse growth differentiation factor 5 (Gdf5).
| Tag | Tag Free |
| Expression Host | E. coli |
Transient overexpression lysate of growth differentiation factor 5 (GDF5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Gdf5 (untagged) - Mouse growth differentiation factor 5 (Gdf5), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human growth differentiation factor 5 (GDF5), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-GDF5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GDF5 antibody is: synthetic peptide directed towards the C-terminal region of GDF5. Synthetic peptide located within the following region: YLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAP |
BMP14 / GDF5 (382-501, His-tag) human protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
BMP14 / GDF5 (382-501, His-tag) human protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
BMP14 / GDF5 (376-495, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
BMP14 / GDF5 (376-495, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
For quantitative detection of rat GDF5 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).
| Assay Type | Sandwich ELISA kit of Quantitative Detection for rat GDF5 |
| Format | 8x12 divisible strips |
| Reactivities | Rat |
For quantitative detection of mouse GDF5 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).
| Assay Type | Sandwich ELISA kit of Quantitative Detection for mouse GDF5 |
| Format | 8x12 divisible strips |
| Reactivities | Mouse |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of Bovine GDF5. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Bovine Gdf5 |
| Format | 8x12 divisible strips |
| Reactivities | Bovine |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of chicken GDF5. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Chicken Gdf5 |
| Format | 8x12 divisible strips |
| Reactivities | Chicken |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of horse equine GDF5. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Equine Gdf5 |
| Format | 8x12 divisible strips |
| Reactivities | Equine |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of Chinese hamster GDF5. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Hamster Gdf5 |
| Format | 8x12 divisible strips |
| Reactivities | Hamster |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of Pig porcine GDF5. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Pig Gdf5 |
| Format | 8x12 divisible strips |
| Reactivities | Pig |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of monkey primate GDF5. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Monkey Gdf5 |
| Format | 8x12 divisible strips |
| Reactivities | Monkey |
Sandwich High Sensitivity ELISA kit for Quantitative Detection of rabbit GDF5. 96wells/kit, with removable strips.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Rabbit Gdf5 |
| Format | 8x12 divisible strips |
| Reactivities | Rabbit |
GDF5 CRISPRa kit - CRISPR gene activation of human growth differentiation factor 5
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Gdf5 CRISPRa kit - CRISPR gene activation of mouse growth differentiation factor 5
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene GDF5
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene GDF5
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
GDF5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qSTAR qPCR primer pairs against Mus musculus gene Gdf5
Gdf5 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
GDF5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GDF5 |
GDF5 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human GDF5 (NP_000548.2). |
| Modifications | Unmodified |
GDF5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 202-501 of human GDF5 (NP_000548.2). |
| Modifications | Unmodified |
Transient overexpression of GDF5 (NM_000557) in HEK293T cells paraffin embedded controls for ICC/IHC staining
GDF5 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
GDF5 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- GDF5