Products

View as table Download

Rabbit Polyclonal Anti-HNRPD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPD antibody: synthetic peptide directed towards the C terminal of human HNRPD. Synthetic peptide located within the following region: YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP

Rabbit Polyclonal Anti-HNRPD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPD antibody: synthetic peptide directed towards the N terminal of human HNRPD. Synthetic peptide located within the following region: AESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTK

Rabbit polyclonal hnRPD (Ab-83) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human hnRPD around the phosphorylation site of serine 83 (N-S-SP-P-R)

Rabbit anti-HNRNPD Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HNRNPD

Rabbit polyclonal hnRPD (Ser83) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human hnRPD around the phosphorylation site of serine 83 (N-S-SP-P-R).
Modifications Phospho-specific

Rabbit Polyclonal Anti-hnRPD Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-hnRPD Antibody: A synthesized peptide derived from human hnRPD

Rabbit Polyclonal Anti-hnRPD Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-hnRPD Antibody: A synthesized peptide derived from human hnRPD

Rabbit Polyclonal Anti-Phospho-hnRPD(Ser83) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-hnRPD(Ser83) Antibody: A synthesized peptide derived from human hnRPD around the phosphorylation site of Sersine 83
Modifications Phospho-specific

Rabbit Polyclonal Anti-hnRPD (Phospho-Ser83) Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-hnRPD (Phospho-Ser83) Antibody: A synthesized peptide derived from human hnRPD (Phospho-Ser83)
Modifications Phospho-specific

HNRNPD rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal HNRNPD Antibody (N-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HNRNPD antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 57-85 amino acids from the N-terminal region of human HNRNPD.

HNRNPD Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human HNRPD

HNRNPD Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-306 of human HNRNPD (NP_002129.2).
Modifications Unmodified