Products

Antibodies (55) ×

cDNA Clones (21)

RNAi (9)

Proteins (8)

Gene Expression (6)

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 55 results

Page 1 of 2

(reset)

Cytokeratin 16 (KRT16) Guinea Pig Polyclonal Antibody

AP09546SU-N

USD 395.00

2 Weeks

Cytokeratin 16 (KRT16) guinea pig polyclonal antibody, Serum

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Immunogen	Synthetic peptide of Human keratin K16 (formerly also designated cytokeratin 16; C-KE QSS SSF SQG QSS), coupled to KLH

Cytokeratin 16 (KRT16) Rabbit Polyclonal Antibody

TA347410

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Keratin 16 Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-Keratin 16 Antibody: A synthesized peptide derived from human Keratin 16

Cytokeratin 16 (KRT16) Rabbit Polyclonal Antibody

TA312853

USD 345.00

In Stock

Rabbit polyclonal Keratin 16 antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human Keratin 16.

1 / 2

2 / 2

Previous Next

Cytokeratin 16 (KRT16) Rabbit Polyclonal Antibody

TA346409

USD 475.00

5 Days

Rabbit Polyclonal Anti-KRT16 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-KRT16 antibody: synthetic peptide directed towards the middle region of human KRT16. Synthetic peptide located within the following region: IAATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLD

Cytokeratin 16 (KRT16) Rabbit Polyclonal Antibody

TA346410

USD 475.00

5 Days

Rabbit Polyclonal Anti-KRT16 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-KRT16 antibody: synthetic peptide directed towards the middle region of human KRT16. Synthetic peptide located within the following region: LRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKN

Cytokeratin 16 (KRT16) Rabbit Polyclonal Antibody

TA348036

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Keratin 16 Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-Keratin 16 Antibody: A synthesized peptide derived from human Keratin 16

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: LL025]

TA353293L

USD 1,140.00

9 Weeks

Mouse monoclonal Anti-Keratin16 Clone LL025

Reactivities	Human
Conjugation	Unconjugated

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI2E6]

CF808255

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KRT16 mouse monoclonal antibody, clone OTI2E6 (formerly 2E6)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI1A9]

CF808269

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KRT16 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications	WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI1G1]

CF808281

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KRT16 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI6A11]

CF808294

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KRT16 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI2H8]

CF808337

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KRT16 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI7A4]

CF808338

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KRT16 mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI2F3]

CF808358

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KRT16 mouse monoclonal antibody,clone OTI2F3

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI2F10]

CF808384

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KRT16 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications	WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI1G5]

CF808398

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) KRT16 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Cytokeratin 16 (KRT16) Rabbit Polyclonal Antibody

TA322577

USD 345.00

4 Weeks

Anti-KRT16 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 195-212 amino acids of Human Keratin, type I cytoskeletal 16

Cytokeratin 16 (KRT16) Rabbit Polyclonal Antibody

TA322578

USD 345.00

In Stock

Anti-KRT16 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 195-212 amino acids of Human Keratin, type I cytoskeletal 16

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Cytokeratin 16 (KRT16) Rabbit Polyclonal Antibody

TA377908

USD 220.00

3 Weeks

Cytokeratin 16 (KRT16) Rabbit polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 190-430 of human Cytokeratin 16 (KRT16) (NP_005548.2).
Modifications	Unmodified

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI2E6]

TA808255

USD 379.00

In Stock

KRT16 mouse monoclonal antibody, clone OTI2E6 (formerly 2E6)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E6]

TA808255AM

USD 420.00

4 Weeks

KRT16 mouse monoclonal antibody, clone OTI2E6 (formerly 2E6), Biotinylated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E6]

TA808255BM

USD 420.00

4 Weeks

KRT16 mouse monoclonal antibody, clone OTI2E6 (formerly 2E6), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI2E6]

TA808255S

USD 159.00

2 Days

KRT16 mouse monoclonal antibody, clone OTI2E6 (formerly 2E6)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI1A9]

TA808269

USD 379.00

In Stock

KRT16 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications	WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A9]

TA808269AM

USD 420.00

4 Weeks

KRT16 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), Biotinylated

Applications	WB
Reactivities	Human, Rat
Conjugation	Biotin

• 

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A9]

TA808269BM

USD 420.00

4 Weeks

KRT16 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), HRP conjugated

Applications	WB
Reactivities	Human, Rat
Conjugation	HRP

• 

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI1A9]

TA808269S

USD 159.00

2 Days

KRT16 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications	WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI1G1]

TA808281

USD 379.00

In Stock

KRT16 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G1]

TA808281AM

USD 420.00

4 Weeks

KRT16 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1), Biotinylated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Biotin

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G1]

TA808281BM

USD 420.00

4 Weeks

KRT16 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	HRP

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI1G1]

TA808281S

USD 159.00

2 Days

KRT16 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI6A11]

TA808294

USD 379.00

In Stock

KRT16 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A11]

TA808294AM

USD 420.00

4 Weeks

KRT16 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11), Biotinylated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6A11]

TA808294BM

USD 420.00

4 Weeks

KRT16 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI6A11]

TA808294S

USD 159.00

2 Days

KRT16 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI2H8]

TA808337

USD 379.00

In Stock

KRT16 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2H8]

TA808337AM

USD 420.00

4 Weeks

KRT16 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8), Biotinylated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Biotin

• 

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H8]

TA808337BM

USD 420.00

4 Weeks

KRT16 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	HRP

• 

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI2H8]

TA808337S

USD 159.00

2 Days

KRT16 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI7A4]

TA808338

USD 379.00

In Stock

KRT16 mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A4]

TA808338AM

USD 420.00

4 Weeks

KRT16 mouse monoclonal antibody, clone OTI7A4 (formerly 7A4), Biotinylated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Biotin

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7A4]

TA808338BM

USD 420.00

4 Weeks

KRT16 mouse monoclonal antibody, clone OTI7A4 (formerly 7A4), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	HRP

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI7A4]

TA808338S

USD 159.00

2 Days

KRT16 mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI2F3]

TA808358

USD 379.00

In Stock

KRT16 mouse monoclonal antibody,clone OTI2F3

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F3]

TA808358AM

USD 420.00

4 Weeks

KRT16 mouse monoclonal antibody,clone OTI2F3, Biotinylated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Biotin

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F3]

TA808358BM

USD 420.00

4 Weeks

KRT16 mouse monoclonal antibody,clone OTI2F3, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	HRP

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI2F3]

TA808358S

USD 159.00

2 Days

KRT16 mouse monoclonal antibody,clone OTI2F3

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody [Clone ID: OTI2F10]

TA808384

USD 379.00

In Stock

KRT16 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications	WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F10]

TA808384AM

USD 420.00

4 Weeks

KRT16 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), Biotinylated

Applications	WB
Reactivities	Human, Rat
Conjugation	Biotin

• 

Cytokeratin 16 (KRT16) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F10]

TA808384BM

USD 420.00

4 Weeks

KRT16 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), HRP conjugated

Applications	WB
Reactivities	Human, Rat
Conjugation	HRP

• 

1 - 50 of 55 results

Page 1 of 2