Products

View as table Download

Rabbit Polyclonal Anti-LDHB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LDHB antibody is: synthetic peptide directed towards the C-terminal region of Human LDHB. Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD

LDHB rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Immunogen L-Lactic Dehydrogenase is isolated and purified from Bovine heart.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

LDHB rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Conjugation Biotin
Immunogen L-Lactic Dehydrogenase is isolated and purified from Bovine heart.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

LDHB rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Immunogen L-Lactic Dehydrogenase is isolated and purified from Bovine heart.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

LDHB rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Porcine
Immunogen L-Lactic Dehydrogenase isolated and purified from Porcine heart.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

LDHB rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Porcine
Conjugation Biotin
Immunogen L-Lactic Dehydrogenase isolated and purified from Porcine heart.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

LDHB rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Porcine
Immunogen L-Lactic Dehydrogenase isolated and purified from Porcine heart.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

LDHB Goat Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Internal region (near C terminus) (NARGLTSVINQKLK)

LDHB mouse monoclonal antibody, clone AT14D7, Purified

Applications ELISA, WB
Reactivities Human

LDHB mouse monoclonal antibody, clone AT14D7, Purified

Applications ELISA, WB
Reactivities Human

Anti-LDHB Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide (KLH-coupled) derived from human LDHB

LDHB Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen internal region (near N terminus) (EEATVPNNKIT)

LDHB Antibody - middlel region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse LDHB

LDHB Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-334 of human LDHB (NP_002291.1).
Modifications Unmodified