Products

cDNA Clones (41)
Proteins (13)
RNAi (13)
Gene Expression (7)
Antibodies (5)
Jump to Filters
View as table Download
MASTL Rabbit Polyclonal Antibody
TA311692

USD 345.00

In Stock

Rabbit polyclonal anti-MASTL antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human MASTL.
MASTL Rabbit Polyclonal Antibody
TA315944

USD 345.00

4 Weeks

Rabbit polyclonal anti-MASTL antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human MASTL.
MASTL Rabbit Polyclonal Antibody
TA343024

USD 375.00

5 Days

Rabbit Polyclonal Anti-MASTL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MASTL antibody: synthetic peptide directed towards the C terminal of human MASTL. Synthetic peptide located within the following region: NKENIVNSFTDKQQTPEKLPIPMIAKNLMCELDEDCEKNSKRDYLSSSFL
MASTL Rabbit Polyclonal Antibody
TA378354

USD 220.00

3 Weeks

MASTL Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 580-879 of human MASTL (NP_001165774.1).
Modifications Unmodified