Germany
Japan
United Kingdom
China
MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human microtubule associated serine/threonine kinase-like (MASTL)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, MASTL (Myc-DDK tagged) - Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, MASTL (mGFP-tagged) - Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Mastl (Myc-DDK-tagged) - Mouse microtubule associated serine/threonine kinase-like (Mastl)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MASTL (GFP-tagged) - Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MASTL - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN403858 is the updated version of KN203858.
Mastl - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN509813 is the updated version of KN309813.
Mastl (GFP-tagged) - Mouse microtubule associated serine/threonine kinase-like (Mastl)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Mastl (Myc-DDK-tagged) - Mouse microtubule associated serine/threonine kinase-like (Mastl)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mastl (Myc-DDK-tagged) - Mouse microtubule associated serine/threonine kinase-like (Mastl), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Mastl (mGFP-tagged) - Mouse microtubule associated serine/threonine kinase-like (Mastl)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mastl (GFP-tagged) - Mouse microtubule associated serine/threonine kinase-like (Mastl), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MASTL (Myc-DDK tagged) - Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MASTL (mGFP-tagged) - Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 3
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of MASTL (mGFP-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 3
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MASTL (mGFP-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MASTL (Myc-DDK-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of MASTL (mGFP-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MASTL (mGFP-tagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
MASTL Mutant (E167D), Myc-DDK-tagged ORF clone of Homo sapiens microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2 as transfection-ready DNA
| Mutation | E167D |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MASTL (GFP-tagged) - Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MASTL (GFP-tagged) - Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Mastl (Myc-DDK-tagged ORF) - Rat microtubule associated serine/threonine kinase-like (Mastl), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Mastl (Myc-DDK-tagged ORF) - Rat microtubule associated serine/threonine kinase-like (Mastl), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mastl (Myc-DDK-tagged ORF) - Rat microtubule associated serine/threonine kinase-like (Mastl), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Mastl (mGFP-tagged ORF) - Rat microtubule associated serine/threonine kinase-like (Mastl), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mastl (GFP-tagged ORF) - Rat microtubule associated serine/threonine kinase-like (Mastl), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
MASTL (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
MASTL (untagged)-Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human microtubule associated serine/threonine kinase-like (MASTL), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
MASTL (untagged)-Kinase deficient mutant (K62M) of Human microtubule associated serine/threonine kinase-like (MASTL)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-MASTL antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MASTL. |
MASTL HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
MASTL - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
Rabbit polyclonal anti-MASTL antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MASTL. |
Rabbit Polyclonal Anti-MASTL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MASTL antibody: synthetic peptide directed towards the C terminal of human MASTL. Synthetic peptide located within the following region: NKENIVNSFTDKQQTPEKLPIPMIAKNLMCELDEDCEKNSKRDYLSSSFL |
MASTL CRISPRa kit - CRISPR gene activation of human microtubule associated serine/threonine kinase like
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Mastl CRISPRa kit - CRISPR gene activation of mouse microtubule associated serine/threonine kinase-like
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene MASTL
| Application | Plasmid of exact quantity for transcript copy number calculation |
Active filters
Target Symbol
- MASTL