Products

Antibodies (22)
cDNA Clones (20)
RNAi (10)
Proteins (8)
Gene Expression (7)
Jump to Filters
View as table Download
MGC13096 (PDCD2L) Rabbit Polyclonal Antibody
TA339771

USD 375.00

5 Days

Rabbit Polyclonal Anti-PDCD2L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDCD2L antibody: synthetic peptide directed towards the N terminal of human PDCD2L. Synthetic peptide located within the following region: FACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGA
MGC13096 (PDCD2L) Mouse Monoclonal Antibody [Clone ID: OTI4F3]
CF812455

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PDCD2L mouse monoclonal antibody,clone OTI4F3

Applications WB
Reactivities Human
Conjugation Unconjugated
MGC13096 (PDCD2L) Mouse Monoclonal Antibody [Clone ID: OTI4H10]
CF812456

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PDCD2L mouse monoclonal antibody,clone OTI4H10

Applications WB
Reactivities Human
Conjugation Unconjugated
MGC13096 (PDCD2L) Mouse Monoclonal Antibody [Clone ID: OTI4H4]
CF812457

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PDCD2L mouse monoclonal antibody,clone OTI4H4

Applications WB
Reactivities Human
Conjugation Unconjugated
MGC13096 (PDCD2L) Mouse Monoclonal Antibody [Clone ID: OTI4E3]
CF812472

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PDCD2L mouse monoclonal antibody,clone OTI4E3

Applications WB
Reactivities Human
Conjugation Unconjugated
MGC13096 (PDCD2L) Rabbit Polyclonal Antibody
TA379716

USD 220.00

3 Weeks

PDCD2L Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-358 of human PDCD2L (NP_115722.1).
Modifications Unmodified