Germany
Japan
United Kingdom
China
NR1D1 (Myc-DDK-tagged)-Human nuclear receptor subfamily 1, group D, member 1 (NR1D1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
CRY1 (Myc-DDK-tagged)-Human cryptochrome 1 (photolyase-like) (CRY1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human casein kinase 1, epsilon (CSNK1E), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
NR1D1 (untagged)-Human nuclear receptor subfamily 1, group D, member 1 (NR1D1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CRY1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CRY1 antibody: synthetic peptide directed towards the N terminal of human CRY1. Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF |
BHLHE41 (untagged)-Human basic helix-loop-helix family, member e41 (BHLHE41)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC310341 is the updated version of SC109802.
NPAS2 (untagged)-Human neuronal PAS domain protein 2 (NPAS2)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Active filters
Pathways
- Circadian rhythm - mammal
Citations
- Yes