Germany
Japan
United Kingdom
China
CBS (Myc-DDK-tagged)-Human cystathionine-beta-synthase (CBS), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 477.00
In Stock
PSAT1 (Myc-DDK-tagged)-Human phosphoserine aminotransferase 1 (PSAT1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
SRR (Myc-DDK-tagged)-Human serine racemase (SRR)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
CTH (Myc-DDK-tagged)-Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
USD 98.00
USD 560.00
In Stock
DLD (Myc-DDK-tagged)-Human dihydrolipoamide dehydrogenase (DLD)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
CTH (Myc-DDK-tagged)-Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
GNMT (Myc-DDK-tagged)-Human glycine N-methyltransferase (GNMT)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SHMT1 (Myc-DDK-tagged)-Human serine hydroxymethyltransferase 1 (soluble) (SHMT1), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
DLD (GFP-tagged) - Human dihydrolipoamide dehydrogenase (DLD)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MAOA (untagged)-Human monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
DLD (untagged)-Human dihydrolipoamide dehydrogenase (DLD)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
GLDC (untagged)-Human glycine dehydrogenase (decarboxylating) (GLDC), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ALAS2 (untagged)-Human aminolevulinate, delta-, synthase 2 (ALAS2), nuclear gene encoding mitochondrial protein, transcript variant 3
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CBS Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE |
Active filters
Pathways
- Glycine
Citations
- Yes