Germany
Japan
United Kingdom
China
Recombinant protein of human Fibroblast Growth Factor-basic (FGF2) produced in E. coli
| Tag | Tag Free |
| Expression Host | E. coli |
Products
View as table Download
FGF2 (Myc-DDK-tagged)-Human fibroblast growth factor 2 (basic) (FGF2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
FGF2 (untagged)-Human fibroblast growth factor 2 (basic) (FGF2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
FGF2 (GFP-tagged) - Human fibroblast growth factor 2 (basic) (FGF2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Active filters
Target Symbol
- FGF2
Citations
- Yes