Germany
Japan
United Kingdom
China
Recombinant protein of human Fibroblast Growth Factor-basic (FGF2) produced in E. coli
| Tag | Tag Free |
| Expression Host | E. coli |
Products
View as table Download
FGF2 (Myc-DDK-tagged)-Human fibroblast growth factor 2 (basic) (FGF2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
FGF2 (untagged)-Human fibroblast growth factor 2 (basic) (FGF2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
FGF2 (GFP-tagged) - Human fibroblast growth factor 2 (basic) (FGF2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, FGF2 (Myc-DDK tagged) - Human fibroblast growth factor 2 (basic) (FGF2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, FGF2 (mGFP-tagged) - Human fibroblast growth factor 2 (basic) (FGF2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Fgf2 (Myc-DDK-tagged) - Mouse fibroblast growth factor 2 (Fgf2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Fgf2 (Myc-DDK-tagged ORF) - Rat fibroblast growth factor 2 (Fgf2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
FGF2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN417426 is the updated version of KN217426.
Fgf2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN505930 is the updated version of KN305930.
Fgf2 (GFP-tagged) - Mouse fibroblast growth factor 2 (Fgf2), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Fgf2 (Myc-DDK-tagged) - Mouse fibroblast growth factor 2 (Fgf2)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fgf2 (Myc-DDK-tagged) - Mouse fibroblast growth factor 2 (Fgf2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Fgf2 (mGFP-tagged) - Mouse fibroblast growth factor 2 (Fgf2)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fgf2 (GFP-tagged) - Mouse fibroblast growth factor 2 (Fgf2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, FGF2 (Myc-DDK tagged) - Human fibroblast growth factor 2 (basic) (FGF2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, FGF2 (mGFP-tagged) - Human fibroblast growth factor 2 (basic) (FGF2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Fgf2 (Myc-DDK-tagged ORF) - Rat fibroblast growth factor 2 (Fgf2), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fgf2 (Myc-DDK-tagged ORF) - Rat fibroblast growth factor 2 (Fgf2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Fgf2 (mGFP-tagged ORF) - Rat fibroblast growth factor 2 (Fgf2), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Fgf2 (GFP-tagged ORF) - Rat fibroblast growth factor 2 (Fgf2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Purified recombinant protein of Mouse fibroblast growth factor 2 (Fgf2).
| Tag | Tag Free |
| Expression Host | E. coli |
Purified recombinant protein of Human fibroblast growth factor 2 (basic) (FGF2).
| Tag | Tag Free |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-FGF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Lenti ORF clone of Human fibroblast growth factor 2 (basic) (FGF2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human fibroblast growth factor 2 (basic) (FGF2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human fibroblast growth factor 2 (basic) (FGF2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Purified recombinant protein of Human fibroblast growth factor 2 (basic) (FGF2)
| Tag | Tag Free |
| Expression Host | E. coli |
qSTAR qPCR primer pairs against Homo sapiens gene FGF2
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Purified recombinant protein of Mouse fibroblast growth factor 2 (Fgf2)
| Tag | Tag Free |
| Expression Host | E. coli |
FGF basic / FGF2 rat recombinant protein, 50 µg
| Expression Host | E. coli |
Transient overexpression lysate of fibroblast growth factor 2 (basic) (FGF2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human fibroblast growth factor 2 (basic) (FGF2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
FGF2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
FGF2 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
FGF basic / FGF2 rat recombinant protein, 10 µg
| Expression Host | E. coli |
FGF basic / FGF2 mouse recombinant protein, 50 µg
| Expression Host | E. coli |
FGF basic / FGF2 mouse recombinant protein, 10 µg
| Expression Host | E. coli |
FGF basic / FGF2 human recombinant protein, 10 µg
| Expression Host | E. coli |
FGF basic / FGF2 human recombinant protein, 25 µg
| Expression Host | E. coli |
FGF basic / FGF2 human recombinant protein, 50 µg
| Expression Host | E. coli |
FGF2 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
Purified recombinant protein of Rat fibroblast growth factor 2 (Fgf2).
| Tag | Tag Free |
| Expression Host | E. coli |
Human FGF-b ELISA Kit (96-well)
| Assay Type | Solid Phase Sandwich ELISA |
| Format | 96-well strip plate |
| Reactivities | Human |
FGF2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FGF2 |
FGF2 mouse monoclonal antibody, clone F-474, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FGF2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Fgf2 (untagged) - Mouse fibroblast growth factor 2 (Fgf2), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Fgf2
Active filters
Target Symbol
- FGF2