Products

View as table Download

Goat Anti-F2R / PAR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TRARRPESKATNAT, from the Internal region (near N-terminus) of the protein sequence according to NP_001983.2.

Rabbit Polyclonal Anti-Human Protease-activated Receptor-1 (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide (C)KNESGLTEYRLVSINK, corresponding to amino acid residues 61-76 of human PAR-1. Extracellular, N terminal.

Rabbit Polyclonal Anti-Thrombin Receptor Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Thrombin Receptor Antibody: A synthesized peptide derived from human Thrombin Receptor

Thrombin Receptor (F2R) (24-37) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from the Internal region (near N-terminus) of the human protein sequence according to NP_001983.2

Rabbit polyclonal Thrombin Receptor antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Thrombin Receptor.

Rabbit polyclonal F2R / PAR1 (Cleaved-Ser42) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PAR1.

Rabbit Polyclonal Thrombin Receptor Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. In vivo generated recombinant protein fragment.

Thrombin Receptor (F2R) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-F2R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2R antibody: synthetic peptide directed towards the N terminal of human F2R.

Rabbit Polyclonal Anti-F2R Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen F2R / Thrombin Receptor / PAR1 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human Thrombin Receptor. Percent identity with other species by BLAST analysis: Human, Gibbon, Baboon, Monkey (100%); Gorilla (95%).

Rabbit Polyclonal Anti-F2R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2R antibody: synthetic peptide directed towards the C terminal of human F2R. Synthetic peptide located within the following region: YAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSSAVANRSKKSRALFLSA

Anti-F2R Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor

Anti-F2R Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor