Products

View as table Download

Rabbit Polyclonal Anti-ARF1 Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ARF1 antibody: synthetic peptide directed towards the middle region of human ARF1. Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA

Rabbit Polyclonal antibody to ARF1 (ADP-ribosylation factor 1)

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 162 of ARF1 (Uniprot ID#P84077)

Rabbit Polyclonal antibody to ARF1 (ADP-ribosylation factor 1)

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 50 and 104 of ARF1

Goat Polyclonal Antibody against ARF1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EGLDWLSNQLRNQK, from the C Terminus of the protein sequence according to NP_001019397.1; NP_001649.1; NP_001019398.1; NP_001019399.1.

Anti-ARF1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 100-115 amino acids of Human ADP-ribosylation factor 1

ARF1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated

ARF1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ARF1

ARF1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human ARF1
Modifications Unmodified

ARF1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human ARF1 (NP_001649.1).
Modifications Unmodified

ARF1 Rabbit polyclonal Antibody

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human ARF1