Butyrylcholinesterase (BCHE) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Immunogen | Butyrylcholinesterase isolated and purified from Human serum. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Butyrylcholinesterase (BCHE) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IHC, IP, R, WB |
| Reactivities | Human |
| Immunogen | Butyrylcholinesterase isolated and purified from Human serum. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Butyrylcholinesterase (BCHE) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Butyrylcholinesterase isolated and purified from Human serum. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit anti-BCHE Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BCHE |
Rabbit Polyclonal Anti-BCHE Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCHE antibody: synthetic peptide directed towards the N terminal of human BCHE. Synthetic peptide located within the following region: SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ |
BCHE rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human BCHE |
Germany
Japan
United Kingdom
China
