Germany
Japan
United Kingdom
China
Cholecystokinin (CCK) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 21-70 of Human CCK. |
Products
View as table Download
Rabbit Polyclonal Anti-CCK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCK antibody: synthetic peptide directed towards the middle region of human CCK. Synthetic peptide located within the following region: IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS |
Rabbit polyclonal anti Cholecystokinin Octapeptide (desulfated); diluted antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Cholecystokinin Octapeptide (desulfated); neat antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Cholecystokinin Octapeptide (desulfated); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 coupled to a carrier protein. |
CCK rabbit polyclonal antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CCK |
Active filters
Target Symbol
- CCK
Clonalities
- Polyclonal