Germany
Japan
United Kingdom
China
CD79A rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CD79A |
Products
View as table Download
Rabbit polyclonal anti-CD79A antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CD79A. |
Rabbit Polyclonal Anti-CD79A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD79A antibody is: synthetic peptide directed towards the C-terminal region of Human CD79A. Synthetic peptide located within the following region: AVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRG |
Rabbit anti CD79a Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HAO1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CD79A |
CD79a Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 33-145 of human CD79a (NP_001774.1). |
| Modifications | Unmodified |
CD79a Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human CD79a |
CD79a Mouse monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthesized peptide derived from human CD79a |
Active filters
Target Symbol
- CD79A
Clonalities
- Polyclonal