CD79A (Myc-DDK-tagged)-Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CD79A (Myc-DDK-tagged)-Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Cd79a (GFP-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (cDNA clone MGC:41188 IMAGE:1332396)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Cd79a (Myc-DDK-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (Cd79a)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CD79A (Myc-DDK tagged) - Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CD79A (mGFP-tagged) - Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CD79A (GFP-tagged) - Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CD79A (Myc-DDK-tagged)-Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CD79A - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Cd79a - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Cd79a (GFP-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (Cd79a), (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Cd79a (Myc-DDK-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (cDNA clone MGC:41188 IMAGE:1332396)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Cd79a (Myc-DDK-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (cDNA clone MGC:41188 IMAGE:1332396)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Cd79a (Myc-DDK-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (cDNA clone MGC:41188 IMAGE:1332396), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Cd79a (mGFP-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (cDNA clone MGC:41188 IMAGE:1332396)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Cd79a (GFP-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (cDNA clone MGC:41188 IMAGE:1332396), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Cd79a (Myc-DDK-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (Cd79a)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Cd79a (Myc-DDK-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (Cd79a), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Cd79a (mGFP-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (Cd79a)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Cd79a (GFP-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (Cd79a), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CD79A (Myc-DDK tagged) - Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CD79A (mGFP-tagged) - Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CD79A (Myc-DDK tagged) - Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CD79A (mGFP-tagged) - Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CD79A (GFP-tagged) - Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CD79A (untagged)-Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Cd79a (untagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (cDNA clone MGC:41188 IMAGE:1332396), (10ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Cd79a (untagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (Cd79a), (10ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
CD79A rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CD79A |
Recombinant protein of human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1, expressed in human cells
Tag | C-DDK/His |
Expression Host | HEK293 |
Lenti ORF clone of Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CD79A (untagged)-Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-CD79A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CD79A. |
CD79A HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
CD79A (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression lysate of CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Mouse Monoclonal CD79a Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CD79A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD79A antibody is: synthetic peptide directed towards the C-terminal region of Human CD79A. Synthetic peptide located within the following region: AVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRG |
Mouse monoclonal Anti-CD79a Clone HM57
Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Opossum, Primate, Rabbit, Rat, Pig, Horse |
Conjugation | Unconjugated |
Mouse monoclonal Anti-CD79a Clone JCB117
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Anti-CD17a Clone HM47
Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Opossum, Primate, Rabbit, Rat, Pig, Horse |
Conjugation | Unconjugated |
Rabbit anti CD79a Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD79A mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD79A mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CD79A CRISPRa kit - CRISPR gene activation of human CD79a molecule
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Cd79a CRISPRa kit - CRISPR gene activation of mouse CD79A antigen (immunoglobulin-associated alpha)
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |