Products

View as table Download

CD79A (Myc-DDK-tagged)-Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Cd79a (GFP-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (cDNA clone MGC:41188 IMAGE:1332396)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

USD 68.00

USD 219.00

In Stock

Cd79a (Myc-DDK-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (Cd79a)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, CD79A (Myc-DDK tagged) - Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, CD79A (mGFP-tagged) - Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

CD79A (GFP-tagged) - Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

USD 98.00

USD 390.00

In Stock

CD79A (Myc-DDK-tagged)-Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

CD79A - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN415284 is the updated version of KN215284.

Cd79a - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN502939 is the updated version of KN302939.

Cd79a (GFP-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (Cd79a), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Cd79a (Myc-DDK-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (cDNA clone MGC:41188 IMAGE:1332396)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Cd79a (Myc-DDK-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (cDNA clone MGC:41188 IMAGE:1332396)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Cd79a (Myc-DDK-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (cDNA clone MGC:41188 IMAGE:1332396), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Cd79a (mGFP-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (cDNA clone MGC:41188 IMAGE:1332396)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Cd79a (GFP-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (cDNA clone MGC:41188 IMAGE:1332396), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Cd79a (Myc-DDK-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (Cd79a)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Cd79a (Myc-DDK-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (Cd79a), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Cd79a (mGFP-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (Cd79a)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Cd79a (GFP-tagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (Cd79a), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CD79A (Myc-DDK tagged) - Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CD79A (mGFP-tagged) - Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CD79A (Myc-DDK tagged) - Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CD79A (mGFP-tagged) - Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

CD79A (GFP-tagged) - Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CD79A (untagged)-Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Cd79a (untagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (cDNA clone MGC:41188 IMAGE:1332396), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Cd79a (untagged) - Mouse CD79A antigen (immunoglobulin-associated alpha) (Cd79a), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

CD79A rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CD79A

Recombinant protein of human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1, expressed in human cells

Tag C-DDK/His
Expression Host HEK293

Lenti ORF clone of Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

CD79A (untagged)-Human CD79a molecule, immunoglobulin-associated alpha (CD79A), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal anti-CD79A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CD79A.

CD79A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

CD79A (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Mouse Monoclonal CD79a Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-CD79A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD79A antibody is: synthetic peptide directed towards the C-terminal region of Human CD79A. Synthetic peptide located within the following region: AVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRG

Mouse monoclonal Anti-CD79a Clone HM57

Reactivities Bovine, Chicken, Guinea Pig, Human, Mouse, Opossum, Primate, Rabbit, Rat, Pig, Horse
Conjugation Unconjugated

Mouse monoclonal Anti-CD79a Clone JCB117

Reactivities Human
Conjugation Unconjugated

Mouse monoclonal Anti-CD17a Clone HM47

Reactivities Bovine, Chicken, Guinea Pig, Human, Mouse, Opossum, Primate, Rabbit, Rat, Pig, Horse
Conjugation Unconjugated

Rabbit anti CD79a Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CD79A mouse monoclonal antibody, clone OTI5E2 (formerly 5E2)

Applications IHC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CD79A mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

CD79A CRISPRa kit - CRISPR gene activation of human CD79a molecule

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Cd79a CRISPRa kit - CRISPR gene activation of mouse CD79A antigen (immunoglobulin-associated alpha)

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector