Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit polyclonal anti human Galanin
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu- Thr-Ser-OH coupled to carrier protein. |
Guinea pig polyclonal anti Galanin (hu); neat antiserum
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu- Thr-Ser-OH coupled to carrier protein. |
Rabbit Polyclonal Anti-GAL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GAL antibody: synthetic peptide directed towards the middle region of human GAL. Synthetic peptide located within the following region: LNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENN |
Rabbit polyclonal anti Galanin (hu); diluted antiserum
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu- Thr-Ser-OH coupled to carrier protein. |
Rabbit polyclonal anti Galanin (hu); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu- Thr-Ser-OH coupled to carrier protein. |
Rabbit polyclonal anti Galanin (po); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala- NH2 coupled to carrier protein. |
Rabbit polyclonal anti Galanin (po); diluted antiserum
| Applications | ELISA |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala- NH2 coupled to carrier protein. |
Rabbit polyclonal anti Galanin (po); neat antiserum
| Applications | ELISA |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala- NH2 coupled to carrier protein. |
Rabbit polyclonal anti Galanin (ms, rt); diluted antiserum
| Applications | ELISA |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr- NH2 coupled to carrier protein. |
Rabbit polyclonal anti Galanin (ms, rt); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr- NH2 coupled to a carrier protein. |
Guinea pig polyclonal anti Galanin (po); diluted antiserum
| Applications | ELISA |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala- NH2 coupled to carrier protein. |
Guinea pig polyclonal anti Galanin (porcine) , neat antiserum
| Applications | ELISA |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly- Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala- NH2 coupled to carrier protein. |
Active filters
Target Symbol
- GAL
Clonalities
- Polyclonal