Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against Vitamin D-binding protein / GC
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDNLSTKNSKFED, from the internal region of the protein sequence according to NP_000574.2. |
Products
View as table Download
Rabbit Polyclonal Anti-GC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GC antibody: synthetic peptide directed towards the N terminal of human GC. Synthetic peptide located within the following region: KHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLV |
Anti-GC Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 217-474 amino acids of human group-specific component (vitamin D binding protein) |
GC Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 324-493 of human GC (NP_001191236.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GC
Clonalities
- Polyclonal