Products

View as table Download

Rabbit Polyclonal anti-GTF2H3 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2H3 antibody: synthetic peptide directed towards the N terminal of human GTF2H3. Synthetic peptide located within the following region: VIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSAN

Rabbit Polyclonal anti-GTF2H3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GTF2H3 antibody is: synthetic peptide directed towards the middle region of Human GTF2H3. Synthetic peptide located within the following region: KGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQY

Rabbit polyclonal anti-Gtf2h3 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Gtf2h3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YPGKNGGLGDFFGDPGNALPDCNPSGSKDGKYELLTVANEVIAEEIKDLM

GTF2H3 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-308 of human GTF2H3 (NP_001507.2).
Modifications Unmodified