Germany
Japan
United Kingdom
China
GTF2H3 (Myc-DDK-tagged)-Human general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, GTF2H3 (Myc-DDK tagged) - Human general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GTF2H3 (mGFP-tagged) - Human general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Gtf2h3 (Myc-DDK-tagged) - Mouse general transcription factor IIH, polypeptide 3 (Gtf2h3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GTF2H3 (GFP-tagged) - Human general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GTF2H3 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN409399 is the updated version of KN209399.
Gtf2h3 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN507423 is the updated version of KN307423.
Gtf2h3 (GFP-tagged) - Mouse general transcription factor IIH, polypeptide 3 (Gtf2h3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Gtf2h3 (Myc-DDK-tagged) - Mouse general transcription factor IIH, polypeptide 3 (Gtf2h3)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gtf2h3 (Myc-DDK-tagged) - Mouse general transcription factor IIH, polypeptide 3 (Gtf2h3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gtf2h3 (mGFP-tagged) - Mouse general transcription factor IIH, polypeptide 3 (Gtf2h3)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gtf2h3 (GFP-tagged) - Mouse general transcription factor IIH, polypeptide 3 (Gtf2h3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GTF2H3 (Myc-DDK tagged) - Human general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GTF2H3 (mGFP-tagged) - Human general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GTF2H3 (Myc-DDK tagged) - Homo sapiens general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GTF2H3 (Myc-DDK tagged) - Homo sapiens general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GTF2H3 (Myc-DDK tagged) - Homo sapiens general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GTF2H3 (GFP-tagged) - Homo sapiens general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GTF2H3 (GFP-tagged) - Homo sapiens general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GTF2H3 (GFP-tagged) - Homo sapiens general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Gtf2h3 (Myc-DDK-tagged ORF) - Rat general transcription factor IIH, polypeptide 3 (Gtf2h3), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Gtf2h3 (Myc-DDK-tagged ORF) - Rat general transcription factor IIH, polypeptide 3 (Gtf2h3), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gtf2h3 (Myc-DDK-tagged ORF) - Rat general transcription factor IIH, polypeptide 3 (Gtf2h3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gtf2h3 (mGFP-tagged ORF) - Rat general transcription factor IIH, polypeptide 3 (Gtf2h3), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gtf2h3 (GFP-tagged ORF) - Rat general transcription factor IIH, polypeptide 3 (Gtf2h3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
GTF2H3 (untagged)-Human general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Gtf2h3 (untagged) - Mouse general transcription factor IIH, polypeptide 3 (Gtf2h3), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
GTF2H3 (untagged)-Human general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal anti-GTF2H3 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H3 antibody: synthetic peptide directed towards the N terminal of human GTF2H3. Synthetic peptide located within the following region: VIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSAN |
Transient overexpression lysate of general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal anti-GTF2H3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GTF2H3 antibody is: synthetic peptide directed towards the middle region of Human GTF2H3. Synthetic peptide located within the following region: KGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQY |
Rabbit polyclonal anti-Gtf2h3 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Gtf2h3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YPGKNGGLGDFFGDPGNALPDCNPSGSKDGKYELLTVANEVIAEEIKDLM |
Carrier-free (BSA/glycerol-free) GTF2H3 mouse monoclonal antibody,clone OTI4B5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GTF2H3 mouse monoclonal antibody,clone OTI6E12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GTF2H3 CRISPRa kit - CRISPR gene activation of human general transcription factor IIH subunit 3
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Gtf2h3 CRISPRa kit - CRISPR gene activation of mouse general transcription factor IIH, polypeptide 3
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene GTF2H3
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene GTF2H3
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
GTF2H3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Gtf2h3
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Gtf2h3
Gtf2h3 (untagged ORF) - Rat general transcription factor IIH, polypeptide 3 (Gtf2h3), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of general transcription factor IIH polypeptide 3 34kDa (GTF2H3) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
GTF2H3 (untagged) - Homo sapiens general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
GTF2H3 (untagged) - Homo sapiens general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
GTF2H3 (untagged) - Homo sapiens general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
Active filters
Target Symbol
- GTF2H3