IL9 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%), E.coli derived 14.0 kDa recombinant Human IL-9 |
IL9 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%), E.coli derived 14.0 kDa recombinant Human IL-9 |
Rabbit Polyclonal IL-9 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | IL-9 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human IL-9. |
Il9 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, WB |
Reactivities | Mouse |
Immunogen | Highly pure (>98%) recombinant mIL-9 |
Il9 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, WB |
Reactivities | Mouse |
Immunogen | Highly pure (>98%) recombinant mIL-9 |
IL9 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%), E.coli derived 14.0 kDa recombinant Human IL-9 |
Anti-Human IL-9 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-9 |
Il9 rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Mouse |
Conjugation | Biotin |
Immunogen | Highly pure (>98%) recombinant mIL-9. |
Il9 rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Mouse |
Conjugation | Biotin |
Immunogen | Highly pure (>98%) recombinant mIL-9. |
IL9 rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure (>98%) recombinant hIL-9 (human IL-9). |
IL9 rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure (>98%) recombinant hIL-9 (human IL-9). |
Rabbit polyclonal anti-IL-9 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-9 protein. |
Rabbit polyclonal IL-9 antibody Peroxidase Conjugated
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-9 protein. |
Biotinylated Anti-Human IL-9 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-9 |
Biotinylated Anti-Murine IL-9 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Murine |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Murine IL-9 |
Anti-Murine IL-9 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Murine |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Murine IL-9 |
Rabbit Polyclonal Anti-IL9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IL9 Antibody: synthetic peptide directed towards the middle region of human IL9. Synthetic peptide located within the following region: SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT |
IL9 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IL9 |