Germany
Japan
United Kingdom
China
IL9 (Myc-DDK-tagged)-Human interleukin 9 (IL9)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Il9 (Myc-DDK-tagged) - Mouse interleukin 9 (Il9)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL9 (GFP-tagged) - Human interleukin 9 (IL9)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IL9 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN409682 is the updated version of KN209682.
Il9 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN508298 is the updated version of KN308298.
Il9 (GFP-tagged) - Mouse interleukin 9 (Il9), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Il9 (Myc-DDK-tagged) - Mouse interleukin 9 (Il9)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Il9 (Myc-DDK-tagged) - Mouse interleukin 9 (Il9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Il9 (mGFP-tagged) - Mouse interleukin 9 (Il9)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Il9 (GFP-tagged) - Mouse interleukin 9 (Il9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human interleukin 9 (IL9), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IL9 (Myc-DDK tagged) - Human interleukin 9 (IL9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human interleukin 9 (IL9), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IL9 (mGFP-tagged) - Human interleukin 9 (IL9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Il9 (Myc-DDK-tagged ORF) - Rat interleukin 9 (Il9), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Il9 (Myc-DDK-tagged ORF) - Rat interleukin 9 (Il9), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Il9 (Myc-DDK-tagged ORF) - Rat interleukin 9 (Il9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Il9 (mGFP-tagged ORF) - Rat interleukin 9 (Il9), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Il9 (GFP-tagged ORF) - Rat interleukin 9 (Il9), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Purified recombinant protein of Mouse interleukin 9 (Il9).
| Tag | Tag Free |
| Expression Host | E. coli |
Il9 (untagged) - Mouse interleukin 9 (Il9), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Homo sapiens gene IL9
IL9 (untagged)-Human interleukin 9 (IL9)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Purified recombinant protein of Human interleukin 9 (IL9).
| Tag | Tag Free |
| Expression Host | E. coli |
Purified recombinant protein of Human interleukin 9 (IL9)
| Tag | Tag Free |
| Expression Host | Sf9 |
Transient overexpression lysate of interleukin 9 (IL9)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
IL9 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%), E.coli derived 14.0 kDa recombinant Human IL-9 |
Il9 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, WB |
| Reactivities | Mouse |
| Immunogen | Highly pure (>98%) recombinant mIL-9 |
Il9 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, WB |
| Reactivities | Mouse |
| Immunogen | Highly pure (>98%) recombinant mIL-9 |
IL9 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%), E.coli derived 14.0 kDa recombinant Human IL-9 |
Il9 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Human IL-9 ELISA Kit (48-well)
| Assay Type | Solid Phase Sandwich ELISA |
| Format | 48-well strip plate |
| Reactivities | Human |
IL9 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Il9 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) recombinant mIL-9. |
Il9 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) recombinant mIL-9. |
IL9 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) recombinant hIL-9 (human IL-9). |
IL9 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) recombinant hIL-9 (human IL-9). |
Human IL-9 ELISA Kit (96-well)
| Assay Type | Solid Phase Sandwich ELISA |
| Format | 96-well strip plate |
| Reactivities | Human |
Rabbit polyclonal anti-IL-9 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-9 protein. |
Rabbit polyclonal IL-9 antibody Peroxidase Conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-9 protein. |
Biotinylated Anti-Murine IL-9 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Murine |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Murine IL-9 |
Anti-Murine IL-9 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Murine |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Murine IL-9 |
Rabbit Polyclonal Anti-IL9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL9 Antibody: synthetic peptide directed towards the middle region of human IL9. Synthetic peptide located within the following region: SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT |
Interleukin-9 / IL9 (1-144, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
Interleukin-9 / IL9 (1-144, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
IL9 CRISPRa kit - CRISPR gene activation of human interleukin 9
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Il9 CRISPRa kit - CRISPR gene activation of mouse interleukin 9
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Active filters
Target Symbol
- IL9
Filter by
Species
Reactivities
Antibody Hosts
Clonalities
Conjugates
Expression Hosts
Lentivirus
Vectors
Modifications
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG2 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)