Il9 (NM_008373) Mouse Recombinant Protein

CAT#: TP723249

Purified recombinant protein of Mouse interleukin 9 (Il9).

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MQRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTMSFLKSLLGTFQKTEMQRQKSRP
• Tag: Tag Free
• Predicted MW: 14.3 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: The ED50 as determined by the dose-dependent proliferation of human MO7e cells is > 0.5 ng/ml, corresponding to a specific activity of > 2 x 10^6 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_032399
• Locus ID: 16198
• UniProt ID: P15247
• Cytogenetics: 13 30.06 cM
• Refseq Size: 536
• Refseq ORF: 432
• Synonyms: Il-9; P40
• Summary: Supports IL-2 independent and IL-4 independent growth of helper T-cells. [UniProtKB/Swiss-Prot Function]