Il9 (NM_001105747) Rat Recombinant Protein

CAT#: TP723250

Purified recombinant protein of Rat interleukin 9 (Il9).

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MQRCSTSWGIQHTSYLIENLKDDPSSKCSCSANVTSCLCLPIPSDDCTTPCFQEGMSQVTNATQQSKFSPFFFRVKRIVETLKSNKCQFFSCEKPCNQTTAGNTVSFLKSLLKTFQKTEVQVQRSRA
• Tag: Tag Free
• Predicted MW: 14.3 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001099217
• Locus ID: 116558
• UniProt ID: D4A8I9
• Cytogenetics: 17p14
• Refseq Size: 563
• Refseq ORF: 432
• Summary: cytokine involved in mast cell and megakaryioblastic leukemic cell proliferation and hemopoietic cell growth; human homolog may be involved in Hodgkins disease, malignant lymphoma, and asthma [RGD, Feb 2006]