Products

View as table Download

Rabbit Polyclonal Anti-Nr5a1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Nr5a1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Nr5a1. Synthetic peptide located within the following region: VADQMTLLQNCWSELLVLDHIYRQVQYGKEDSILLVTGQEVELSTVAVQA

Rabbit Polyclonal anti-NR5A1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR5A1 antibody: synthetic peptide directed towards the middle region of human NR5A1. Synthetic peptide located within the following region: AVPGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGP

Rabbit Polyclonal Anti-NR5A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR5A1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QLHALQLDRQEFVCLKFLILFSLDVKFLNNHSLVKDAQEKANAALLDYTL

Rabbit Polyclonal Anti-NR5A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR5A1 antibody: synthetic peptide directed towards the middle region of human NR5A1. Synthetic peptide located within the following region: PGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGPNV

Rabbit Polyclonal Anti-NR5A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR5A1 antibody: synthetic peptide directed towards the middle region of human NR5A1. Synthetic peptide located within the following region: SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA

Rabbit Polyclonal Anti-NR5A1 Antibody (Ligand-binding Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen NR5A1 / SF1 antibody was raised against synthetic 16 amino acid peptide from ligand-binding domain of human NR5A1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Mouse, Rat, Hamster, Elephant, Dog, Horse, Pig (94%); Monkey, Sheep, Panda, Bovine, Rabbit (88%); Opossum, Platypus (81%).

Rabbit Polyclonal Anti-NR5A1 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen NR5A1 / SF1 antibody was raised against synthetic 17 amino acid peptide from internal region of human NR5A1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bat (100%); Elephant, Panda, Dog, Bovine, Rabbit, Horse, Pig (94%); Mouse, Rat, Hamster (88%); Turkey, Chicken, Platypus, Xenopus (82%).

NR5A1 Antibody - middlel region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse NR5A1

NR5A1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NR5A1

Steroidogenic factor-1 (SF-1/NR5A1) Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Steroidogenic factor-1 (SF-1/Steroidogenic factor-1 (SF-1/NR5A1)) (NP_004950.2).
Modifications Unmodified