Products

Jump to Filters
View as table Download
PACE4 (PCSK6) Rabbit Polyclonal Antibody
TA344558

USD 475.00

5 Days

Rabbit Polyclonal Anti-PCSK6 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCSK6 antibody: synthetic peptide directed towards the N terminal of human PCSK6. Synthetic peptide located within the following region: NYDSYASYDVNGNDYDPSPRYDASNENKHGTRCAGEVAASANNSYCIVGI
PACE4 (PCSK6) Goat Polyclonal Antibody
TA317144

USD 425.00

2 Weeks

PACE4 / PCSK6 Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen PACE4 / PCSK6 antibody was raised against synthetic peptide PDCEPGTYFDSE from an internal region of human PCSK6 / PACE4 (NP_002561.1; NP_612192.1; NP_612195.1; NP_612197.1; NP_612196.1; NP_612198.2; NP_612193.1; NP_612194.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Panda (92%); Platypus, Poplar (83%).
PACE4 (PCSK6) Goat Polyclonal Antibody
AP31111PU-N

USD 375.00

5 Days

PACE4 (PCSK6) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_002561.1; NP_612192.1; NP_612195.1; NP_612197.1; NP_612196.1; NP_612198.2; NP_612193.1; NP_612194.1.
PACE4 (PCSK6) Rabbit Polyclonal Antibody
TA329886

USD 310.00

5 Days

Rabbit Polyclonal Anti-PCSK6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCSK6 antibody: synthetic peptide directed towards the N terminal of human PCSK6. Synthetic peptide located within the following region: IYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGR
PACE4 (PCSK6) Rabbit Polyclonal Antibody
TA341045

USD 425.00

5 Days

Rabbit Polyclonal Anti-PCSK6 Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen PACE4 / PCSK6 antibody was raised against synthetic 16 amino acid peptide from internal region of human PACE4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Rabbit (100%); Marmoset (94%); Mouse, Rat, Elephant, Panda, Bovine, Dog, Horse, Pig, Opossum (88%); Bat (81%).