Products

View as table Download

PML Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PML

Rabbit Polyclonal Anti-PML Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PML antibody: synthetic peptide directed towards the middle region of human PML. Synthetic peptide located within the following region: TTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQ

Rabbit Polyclonal PML Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PML antibody: human PML (Promyelocytic leukemia), using 3 different KLH-conjugated synthetic peptides.

Rabbit polyclonal anti-PML antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PML.

Rabbit Polyclonal Anti-PML Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PML Antibody: synthetic peptide directed towards the C terminal of human PML. Synthetic peptide located within the following region: EGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFR

Rabbit Polyclonal Anti-PML Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PML Antibody: synthetic peptide directed towards the N terminal of human PML. Synthetic peptide located within the following region: PSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEAS

PML Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PML

PML Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PML

PML(isoform 5) Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human PML.
Modifications Unmodified

PML(isoform 5) Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PML.
Modifications Unmodified

PML/RARA Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PML/RARA
Modifications Unmodified