Products

View as table Download

VEGFC Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human VEGFC
Modifications Unmodified

VEGFC Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human VEGFC
Modifications Unmodified

Rabbit polyclonal anti-VEGF-C antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen E. coli-expressed recombinant murine VEGF-C

VEGFC Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human VEGFC (NP_005420.1).
Modifications Unmodified

VEGFC Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human VEGFC (NP_005420.1).
Modifications Unmodified

VEGFC (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 27-57 amino acids from the N-terminal region of human VEGF3

Rabbit Polyclonal Anti-VEGFC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VEGFC antibody is: synthetic peptide directed towards the C-terminal region of Human VEGFC. Synthetic peptide located within the following region: LDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFD

Anti-VEGFC Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 256-270 amino acids of human vascular endothelial growth factor C

VEGFC Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human VEGFC

VEGFC Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the Internal region of human VEGFC. AA range:91-140